PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02771g03017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 116aa    MW: 12766.4 Da    PI: 9.0234
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02771g03017.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof728.6e-2378116240
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryW 40 
                               +e+alkcprC+s+ntkfCy+nnyslsqPr+fCk+Crry+
  Niben101Scf02771g03017.1  78 PETALKCPRCESSNTKFCYFNNYSLSQPRHFCKTCRRYY 116
                               57789*********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2462116IPR003851Zinc finger, Dof-type
PfamPF027018.7E-1980116IPR003851Zinc finger, Dof-type
PROSITE profilePS5088420.79382116IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MVFSSIPAYL DPANWQQQSG GSIPNHHQLT SPPSQTATPP PLPPPPPPLQ PHDSTGGAGS  60
IRPGSMADRA RLANIPMPET ALKCPRCESS NTKFCYFNNY SLSQPRHFCK TCRRYY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758525.13e-65PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_016465077.13e-65PREDICTED: dof zinc finger protein DOF2.4-like
SwissprotO809281e-36DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBLA0A067KKT86e-48A0A067KKT8_JATCU; Uncharacterized protein
STRINGPOPTR_0006s08440.12e-46(Populus trichocarpa)
STRINGSolyc09g010680.2.13e-46(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.17e-35DNA binding with one finger 2.4